Structure of PDB 4imj Chain D Binding Site BS01

Receptor Information
>4imj Chain D (length=192) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKP
NVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTK
EQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGA
FVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4imj Novel Modifications on C-terminal Domain of RNA Polymerase II Can Fine-tune the Phosphatase Activity of Ssu72.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		D13 S14 M17 N18 R19 K44 L45 P46 M48 A49 F50 N144
Binding residue
(residue number reindexed from 1)		D10 S11 M14 N15 R16 K41 L42 P43 M45 A46 F47 N141
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
GO:0016791 phosphatase activity
GO:0017018 myosin phosphatase activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006369 termination of RNA polymerase II transcription
GO:0006397 mRNA processing
GO:0031124 mRNA 3'-end processing
Cellular Component
GO:0005634 nucleus
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4imj, PDBe:4imj, PDBj:4imj
PDBsum4imj
PubMed23844594
UniProtQ9VWE4

[Back to BioLiP]