Structure of PDB 4iht Chain D Binding Site BS01

Receptor Information
>4iht Chain D (length=90) Species: 62977 (Acinetobacter baylyi ADP1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLER
GSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASGHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iht The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S17 F18 T19 Q29 P30 S33
Binding residue
(residue number reindexed from 1)		S17 F18 T19 Q29 P30 S33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4iht, PDBe:4iht, PDBj:4iht
PDBsum4iht
PubMed24100318
UniProtO68014|BENM_ACIAD HTH-type transcriptional regulator BenM (Gene Name=benM)

[Back to BioLiP]