Structure of PDB 4i7z Chain D Binding Site BS01

Receptor Information
>4i7z Chain D (length=38) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPS
Ligand information
Ligand ID1E2
InChIInChI=1S/C11H20O11S/c1-5(12)20-2-6(13)3-21-11-10(16)9(15)8(14)7(22-11)4-23(17,18)19/h6-11,13-16H,2-4H2,1H3,(H,17,18,19)/t6-,7-,8-,9+,10-,11-/m1/s1
InChIKeyGWOURQAWIHLHOD-MPVQUNCYSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6CC(=O)OCC(COC1C(C(C(C(O1)CS(=O)(=O)O)O)O)O)O
OpenEye OEToolkits 1.7.6CC(=O)OC[C@H](CO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1)CS(=O)(=O)O)O)O)O)O
CACTVS 3.370CC(=O)OC[CH](O)CO[CH]1O[CH](C[S](O)(=O)=O)[CH](O)[CH](O)[CH]1O
CACTVS 3.370CC(=O)OC[C@@H](O)CO[C@@H]1O[C@H](C[S](O)(=O)=O)[C@@H](O)[C@H](O)[C@H]1O
ACDLabs 12.01O=S(=O)(O)CC1OC(OCC(O)COC(=O)C)C(O)C(O)C1O
FormulaC11 H20 O11 S
Name(2S)-3-(acetyloxy)-2-hydroxypropyl 6-deoxy-6-sulfo-beta-D-glucopyranoside
ChEMBL
DrugBank
ZINCZINC000098207956
PDB chain4i7z Chain D Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i7z Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
Resolution2.803 Å
Binding residue
(original residue number in PDB)		R16 N20 F24
Binding residue
(residue number reindexed from 1)		R8 N12 F16
Annotation score1
Enzymatic activity
Enzyme Commision number 7.1.1.6: plastoquinol--plastocyanin reductase.
Gene Ontology
Molecular Function
GO:0009496 plastoquinol--plastocyanin reductase activity
GO:0016491 oxidoreductase activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
GO:0046872 metal ion binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0015979 photosynthesis
GO:0055085 transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4i7z, PDBe:4i7z, PDBj:4i7z
PDBsum4i7z
PubMed23514009
UniProtP83794|UCRI_MASLA Cytochrome b6-f complex iron-sulfur subunit (Gene Name=petC)

[Back to BioLiP]