Structure of PDB 4i5b Chain D Binding Site BS01

Receptor Information
>4i5b Chain D (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRF
ASFEAQGALANIACDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELRE
PNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYL
PFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i5b Disruption of hydrogen bonds between major histocompatibility complex class II and the peptide N-terminus is not sufficient to form a human leukocyte antigen-DM receptive state of major histocompatibility complex class II.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		Q9 F24 G58 N62 C65 D66 N69
Binding residue
(residue number reindexed from 1)		Q8 F23 G57 N61 C64 D65 N68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4i5b, PDBe:4i5b, PDBj:4i5b
PDBsum4i5b
PubMed23976922
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]