Structure of PDB 4ht8 Chain D Binding Site BS01

Receptor Information

>4ht8 Chain D (length=61) Species: 469008 (Escherichia coli BL21(DE3))

QSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPS

Ligand information

>4ht8 Chain K (length=7)

aaaaaaa

.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ht8 Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): Y25 G29 I30 K31 L32 Q33 Q52 S60 T61
• Binding residue (residue number reindexed from 1): Y21 G25 I26 K27 L28 Q29 Q48 S56 T57
• Binding affinity: PDBbind-CN: Kd=113nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 18 10:28:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4ht8', asym_id = 'D', bs = 'BS01', title = 'Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4ht8', asym_id='D', bs='BS01', title='Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003723,0006355', uniprot = '', pdbid = '4ht8', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0006355', uniprot='', pdbid='4ht8', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>