Structure of PDB 4hqj Chain D Binding Site BS01

Receptor Information
>4hqj Chain D (length=285) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTY
QDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQK
DDMIFEDCGNVPSELKERGEYNNERGERKVCRSRLEWLGNCSGLNDETYG
YKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRD
EDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTM
DTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Ligand information
>4hqj Chain E (length=29) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FYYDYETVRNGGLIFAALAFIVGLIILLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hqj Crystal structure of Na+, K(+)-ATPase in the Na(+)-bound state.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		Q69 D70 R71 F186
Binding residue
(residue number reindexed from 1)		Q51 D52 R53 F168
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001671 ATPase activator activity
GO:0005391 P-type sodium:potassium-exchanging transporter activity
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0051117 ATPase binding
Biological Process
GO:0006813 potassium ion transport
GO:0006814 sodium ion transport
GO:0006883 intracellular sodium ion homeostasis
GO:0007155 cell adhesion
GO:0010248 establishment or maintenance of transmembrane electrochemical gradient
GO:0030007 intracellular potassium ion homeostasis
GO:0036376 sodium ion export across plasma membrane
GO:0045087 innate immune response
GO:0055085 transmembrane transport
GO:0086009 membrane repolarization
GO:1902600 proton transmembrane transport
GO:1903278 positive regulation of sodium ion export across plasma membrane
GO:1903288 positive regulation of potassium ion import across plasma membrane
GO:1903408 positive regulation of P-type sodium:potassium-exchanging transporter activity
GO:1990573 potassium ion import across plasma membrane
Cellular Component
GO:0005886 plasma membrane
GO:0005890 sodium:potassium-exchanging ATPase complex
GO:0016324 apical plasma membrane
GO:0042383 sarcolemma

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hqj, PDBe:4hqj, PDBj:4hqj
PDBsum4hqj
PubMed24051246
UniProtP05027|AT1B1_PIG Sodium/potassium-transporting ATPase subunit beta-1 (Gene Name=ATP1B1)

[Back to BioLiP]