Structure of PDB 4hjb Chain D Binding Site BS01

Receptor Information

>4hjb Chain D (length=30) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RMKQIEDKLEEILSKLYHIEMELFIKMLLG

Ligand information

>4hjb Chain A (length=29) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RMKQIEDKLEEILSKLYHIEMELFIKMLL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4hjb Differential Impact of beta and gamma Residue Preorganization on alpha / beta / gamma-Peptide Helix Stability in Water.
Resolution	1.25 Å
Binding residue (original residue number in PDB)	R1 Q4
Binding residue (residue number reindexed from 1)	R1 Q4

External links

PDB	RCSB:4hjb, PDBe:4hjb, PDBj:4hjb
PDBsum	4hjb
PubMed	23701135

[Back to BioLiP]