Structure of PDB 4gg6 Chain D Binding Site BS01

Receptor Information
>4gg6 Chain D (length=173) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVT
PLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTI
SPSLLVCSVTDFYPAQIKVRWFQEETTGVVSTPLIRNGDWTFQILVMLEM
RGDVYTCHVEHPSLQNPIIVEWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gg6 Biased T cell receptor usage directed against human leukocyte antigen DQ8-restricted gliadin peptides is associated with celiac disease.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F11 G13 C15 T28 Y30 Y37 Y47 Y60 W61 E74 V78 N82 L85
Binding residue
(residue number reindexed from 1)		F10 G12 C14 T27 Y29 Y36 Y46 Y59 W60 E73 V77 N81 L84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gg6, PDBe:4gg6, PDBj:4gg6
PDBsum4gg6
PubMed23063329
UniProtP01920|DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain (Gene Name=HLA-DQB1)

[Back to BioLiP]