Structure of PDB 4geq Chain D Binding Site BS01

Receptor Information
>4geq Chain D (length=57) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANENILKLKLYRSLGVILDLENDQVLINRDGNIDILPLDNNLSDFYKTKY
IWERLGK
Ligand information
>4geq Chain E (length=18) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPNEVRSFLQDLSQVLAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4geq A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors.
Resolution2.01 Å
Binding residue
(original residue number in PDB)		E157 L160 K163 L164
Binding residue
(residue number reindexed from 1)		E3 L6 K9 L10
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4geq, PDBe:4geq, PDBj:4geq
PDBsum4geq
PubMed23334295
UniProtQ04477|SPC24_YEAST Kinetochore protein SPC24 (Gene Name=SPC24)

[Back to BioLiP]