Structure of PDB 4gbi Chain D Binding Site BS01

Receptor Information
>4gbi Chain D (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTDKT
Ligand information
>4gbi Chain B (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gbi A T3R3 hexamer of the human insulin variant B28Asp.
Resolution2.502 Å
Binding residue
(original residue number in PDB)		V12 E13 Y16 G23 F24 F25 Y26 K29
Binding residue
(residue number reindexed from 1)		V12 E13 Y16 G23 F24 F25 Y26 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4gbi, PDBe:4gbi, PDBj:4gbi
PDBsum4gbi
PubMed23428413
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]