Structure of PDB 4f1b Chain D Binding Site BS01

Receptor Information
>4f1b Chain D (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>4f1b Chain C (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4f1b Structural meta-analysis of regular human insulin in pharmaceutical formulations.
Resolution1.591 Å
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4f1b, PDBe:4f1b, PDBj:4f1b
PDBsum4f1b
PubMed23692694
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]