Structure of PDB 4f02 Chain D Binding Site BS01

Receptor Information
>4f02 Chain D (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNF
QQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKS
IDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMN
GMLLNDRKVFVGRFKSRKEREAEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4f02 Interdomain Allostery Promotes Assembly of the Poly(A) mRNA Complex with PABP and eIF4G.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
Y14 R41 D45 M46 L52 Y54 Y56 N58 M85 S87 Q88 R89 R94 N100 F102 K104 N105 S127 K138 G139 Y140 F142 H144 F173 K174 S175 R176 R179
Binding residue
(residue number reindexed from 1)
Y5 R32 D36 M37 L43 Y45 Y47 N49 M76 S78 Q79 R80 R85 N91 F93 K95 N96 S118 K129 G130 Y131 F133 H135 F164 K165 S166 R167 R170
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4f02, PDBe:4f02, PDBj:4f02
PDBsum4f02
PubMed23041282
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]