Structure of PDB 4ey9 Chain D Binding Site BS01

Receptor Information
>4ey9 Chain D (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>4ey9 Chain C (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ey9 Structural meta-analysis of regular human insulin in pharmaceutical formulations.
Resolution1.471 Å
Binding residue
(original residue number in PDB)
F1 N3 Q4 H5 L6 C7 L11 L15 C19 R22 G23 F24 F25 Y26 P28 K29
Binding residue
(residue number reindexed from 1)
F1 N3 Q4 H5 L6 C7 L11 L15 C19 R22 G23 F24 F25 Y26 P28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4ey9, PDBe:4ey9, PDBj:4ey9
PDBsum4ey9
PubMed23692694
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]