Structure of PDB 4edn Chain D Binding Site BS01

Receptor Information
>4edn Chain D (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLV
LLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPE
DVVNLDLKSTLRVLYNLFTKYKNVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4edn Structural basis for paxillin binding and focal adhesion targeting of beta-parvin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		L271 Y298 F299 V300 H304
Binding residue
(residue number reindexed from 1)		L32 Y59 F60 V61 H65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007155 cell adhesion
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4edn, PDBe:4edn, PDBj:4edn
PDBsum4edn
PubMed22869380
UniProtQ9HBI1|PARVB_HUMAN Beta-parvin (Gene Name=PARVB)

[Back to BioLiP]