Structure of PDB 4e41 Chain D Binding Site BS01

Receptor Information
>4e41 Chain D (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPS
GTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVDRGSTLGRLYFG
RGTQLTVWPDIQKPDPAVYQLRDSVCLFTDFDSQTNVSQYITDKCVLDMR
SMDFKSNSAVAWSACANAFNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4e41 Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
Resolution2.6 Å
Binding residue
(original residue number in PDB)		G91 S92
Binding residue
(residue number reindexed from 1)		G91 S92
External links