Structure of PDB 4cw1 Chain D Binding Site BS01

Receptor Information
>4cw1 Chain D (length=271) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LHTLRYIQTAMTDPGPGQPWFVTVGYVDGELFVHYNSTARRVVPRTEWMA
ANTDQQYWNGQTQIVQGNEQIDRDDLGTLQRRYNQTGGSHTVQLMYGCDI
LEDGTIRGYSQDAYDGRDFIAFDKGTMTFTAAVPEAVPTKRKWEEGDYAE
GLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRA
HGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGD
KYQCRVEHASLPQPGLYSWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cw1 Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		Y7 V34 Q62 I65 V66 N69 I72 D76 R83 Y97 T140 K143 W144 Y149 L153 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)		Y6 V33 Q61 I64 V65 N68 I71 D75 R82 Y96 T139 K142 W143 Y148 L152 Y155 W163 Y167
Enzymatic activity
Enzyme Commision number ?
External links