Structure of PDB 4cvx Chain D Binding Site BS01

Receptor Information
>4cvx Chain D (length=272) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHTLRYIRTAMTDPGPGLPWYVDVGYVDGELFVHYNSTARRYVPRTEWI
AAKADQQYWDGQTQIGQGNEQIDRENLGILQRRYNQTGGSHTVQWMYGCD
ILEGGPIRGYYQMAYDGRDFTAFDKGTMTFTAAVPEAVPTKRKWEEGDYA
EGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCR
AHGFYPRPIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIDAQPGDG
DKYQCRVEHASLPQPGLYSWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cvx Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y7 G61 Q62 I65 N69 I72 N76 R83 W95 M113 T140 K143 W144 Y149 G152 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)		Y7 G61 Q62 I65 N69 I72 N76 R83 W95 M113 T140 K143 W144 Y149 G152 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links