Structure of PDB 4cgv Chain D Binding Site BS01

Receptor Information
>4cgv Chain D (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAY
FRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERV
LELEPNNFEATNELRKISQALAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cgv Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
Resolution2.54 Å
Binding residue
(original residue number in PDB)
N197 R198 S199 A249 S250
Binding residue
(residue number reindexed from 1)
N70 R71 S72 A122 S123
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cgv, PDBe:4cgv, PDBj:4cgv
PDBsum4cgv
PubMed24794838
UniProtQ9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 (Gene Name=RPAP3)

[Back to BioLiP]