Structure of PDB 4c3p Chain D Binding Site BS01

Receptor Information
>4c3p Chain D (length=260) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGV
EHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQK
LSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIAD
FGWSVHAPLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFE
ANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEH
PWITANSSKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4c3p Molecular Mechanism of Aurora a Kinase Autophosphorylation and its Allosteric Activation by Tpx2.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		R126 Q127 W128 D132 E152 S155 F157 K166 E170 R179 E183 S186 G198 Y199 H201
Binding residue
(residue number reindexed from 1)		R2 Q3 W4 D8 E28 S31 F33 K42 E46 R55 E59 S62 G74 Y75 H77
Enzymatic activity
Catalytic site (original residue number in PDB) N261 D274
Catalytic site (residue number reindexed from 1) N137 D150
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0000212 meiotic spindle organization
GO:0000226 microtubule cytoskeleton organization
GO:0000278 mitotic cell cycle
GO:0006468 protein phosphorylation
GO:0007052 mitotic spindle organization
GO:0007098 centrosome cycle
GO:0007100 mitotic centrosome separation
GO:0051321 meiotic cell cycle

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4c3p, PDBe:4c3p, PDBj:4c3p
PDBsum4c3p
PubMed24867643
UniProtO14965|AURKA_HUMAN Aurora kinase A (Gene Name=AURKA)

[Back to BioLiP]