Structure of PDB 4bl0 Chain D Binding Site BS01

Receptor Information
>4bl0 Chain D (length=331) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLL
QSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEA
NLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVK
NKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVA
LLPKEQEGYACSSIDGRVAVEFFSKRFAFRCHRLNLKDTNLAYPVNSIEF
SPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCL
ATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Ligand information
>4bl0 Chain F (length=12) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTSMEMTEVFPR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bl0 Bub3 Reads Phosphorylated Melt Repeats to Promote Spindle Assembly Checkpoint Signaling
Resolution1.95 Å
Binding residue
(original residue number in PDB)		E189 G191 K193 R217 F236 A237 F238 R239 R283 K284 K285
Binding residue
(residue number reindexed from 1)		E189 G191 K193 R217 F227 A228 F229 R230 R274 K275 K276
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0043130 ubiquitin binding
Biological Process
GO:0007094 mitotic spindle assembly checkpoint signaling
GO:0044774 mitotic DNA integrity checkpoint signaling
GO:1902499 positive regulation of protein autoubiquitination
Cellular Component
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0033597 mitotic checkpoint complex
GO:1990298 bub1-bub3 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4bl0, PDBe:4bl0, PDBj:4bl0
PDBsum4bl0
PubMed24066227
UniProtP26449|BUB3_YEAST Cell cycle arrest protein BUB3 (Gene Name=BUB3)

[Back to BioLiP]