Structure of PDB 4a12 Chain D Binding Site BS01

Receptor Information
>4a12 Chain D (length=183) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELR
KRIKLVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKT
GIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARV
VNQTAKHYYVEVKSYVKHTLVFKGNFKMFYDKR
Ligand information
>4a12 Chain F (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccaattatatactactattagtacctagtcttaattccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a12 Structural Basis for Feed-Forward Transcriptional Regulation of Membrane Lipid Homeostasis in Staphylococcus Aureus.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		R13 V38 S39 Q41 T42 R189
Binding residue
(residue number reindexed from 1)		R7 V32 S33 Q35 T36 R183
Binding affinityPDBbind-CN: Kd=0.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0045717 negative regulation of fatty acid biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4a12, PDBe:4a12, PDBj:4a12
PDBsum4a12
PubMed23300457
UniProtQ2FZ56

[Back to BioLiP]