Structure of PDB 3zi5 Chain D Binding Site BS01

Receptor Information
>3zi5 Chain D (length=166) Species: 1399 (Cytobacillus firmus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDETERVTLIVTLGHADTARIQAAPGTTAGQGTQYFWLSKDSYDFFPPLT
IRNRRGTKATYSSLINMNYIDINYTDTQCRVTFEAENNFDFRLGTGKLRY
TGVAKSNDIAAITRVGDSDYELRIIKQGTPEHSQLDPYAVSFIGNRGKRF
GYISNEEFGRIIGVTF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zi5 Structural Insight Into the Specificity of the B3 DNA-Binding Domains Provided by the Co-Crystal Structure of the C-Terminal Fragment of Bfii Restriction Enzyme
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T225 Y227 N245 R247 G248 R272 E276 N279 N280 R284 N337 R338
Binding residue
(residue number reindexed from 1)		T33 Y35 N53 R55 G56 R80 E84 N87 N88 R92 N145 R146
Binding affinityPDBbind-CN: Kd=2nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
External links