Structure of PDB 3zbi Chain D Binding Site BS01

Receptor Information
>3zbi Chain D (length=196) Species: 511693 (Escherichia coli BL21) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIPCGTGTELDTT
VPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWER
IRNDQDGTIVNIDSAGTNSLGSAGIPGQVDAHMWERLRGAIMISLFSDTL
TAQLASEALRSYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
Ligand information
>3zbi Chain C (length=28) Species: 511693 (Escherichia coli BL21) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CSSGHKPPPEPDWSNTVPVNKTIPVDTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zbi Structure of a Bacterial Type Iv Secretion Core Complex at Subnanometre Resolution.
Resolution8.5 Å
Binding residue
(original residue number in PDB)		E709 Y878
Binding residue
(residue number reindexed from 1)		E1 Y170
Enzymatic activity
Enzyme Commision number ?
External links