Structure of PDB 3wkj Chain D Binding Site BS01

Receptor Information
>3wkj Chain D (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLA
HYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>3wkj Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wkj Structure of human nucleosome containing the testis-specific histone variant TSH2B.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T33 Y43 G54 S56 S57 R87 T89
Binding residue
(residue number reindexed from 1)		T1 Y11 G22 S24 S25 R55 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0042393 histone binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006337 nucleosome disassembly
GO:0006954 inflammatory response
GO:0031639 plasminogen activation
GO:0035092 sperm DNA condensation
GO:0051276 chromosome organization
GO:0071674 mononuclear cell migration
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0009986 cell surface

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wkj, PDBe:3wkj, PDBj:3wkj
PDBsum3wkj
PubMed24699735
UniProtQ96A08|H2B1A_HUMAN Histone H2B type 1-A (Gene Name=H2BC1)

[Back to BioLiP]