Structure of PDB 3vyq Chain D Binding Site BS01

Receptor Information
>3vyq Chain D (length=63) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKPVPCGWERVVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYLLKNG
ETFLKPEDFNFTV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vyq Structural basis of the versatile DNA recognition ability of the methyl-CpG binding domain of methyl-CpG binding domain protein 4
Resolution2.525 Å
Binding residue
(original residue number in PDB)		R84 S86 K88 T89 R106
Binding residue
(residue number reindexed from 1)		R15 S17 K19 T20 R37
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3vyq, PDBe:3vyq, PDBj:3vyq
PDBsum3vyq
PubMed23316048
UniProtQ9Z2D7|MBD4_MOUSE Methyl-CpG-binding domain protein 4 (Gene Name=Mbd4)

[Back to BioLiP]