Structure of PDB 3vxr Chain D Binding Site BS01

Receptor Information
>3vxr Chain D (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLI
QSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRMDSSYKL
IFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSK
DSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSII
Ligand information
>3vxr Chain C (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RYPLTFGWCF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vxr Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Y31 R93 D95 Y98
Binding residue
(residue number reindexed from 1)
Y31 R93 D95 Y98
External links