Structure of PDB 3vxm Chain D Binding Site BS01

Receptor Information
>3vxm Chain D (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKY
FSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVGAPSGAG
SYQLTFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNV
SQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSII
Ligand information
>3vxm Chain C (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RFPLTFGWCF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vxm Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
Resolution2.5 Å
Binding residue
(original residue number in PDB)
G28 Y102
Binding residue
(residue number reindexed from 1)
G28 Y102
External links