Structure of PDB 3vd0 Chain D Binding Site BS01

Receptor Information

>3vd0 Chain D (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQ
IKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPAS
HLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSC
VGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ

Ligand information

>3vd0 Chain G (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggcatgcctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3vd0 Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	A137 K138
Binding residue (residue number reindexed from 1)	A25 K26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3vd0, PDBe:3vd0, PDBj:3vd0
PDBsum	3vd0
PubMed	22474346
UniProt	O15350\|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]