Structure of PDB 3v62 Chain D Binding Site BS01

Receptor Information
>3v62 Chain D (length=79) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG
IRIQADQTPEDLDMEDNDIIEAHREQIGG
Ligand information
>3v62 Chain F (length=21) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SQMDIFSQLSRAKKGEIIVID
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3v62 Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H23 F36 F37 X38 I39 X40 R55
Binding residue
(residue number reindexed from 1)		H4 F17 F18 X19 I20 X21 R36
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3v62, PDBe:3v62, PDBj:3v62
PDBsum3v62
PubMed22382979
UniProtQ12306|SMT3_YEAST Ubiquitin-like protein SMT3 (Gene Name=SMT3)

[Back to BioLiP]