Structure of PDB 3ulp Chain D Binding Site BS01

Receptor Information

>3ulp Chain D (length=113) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRNELKSK
TDWHRIVVYDQNIVDLIDKYLRKGRRVYVQGSLHTRKWHTNSQPKQITEI
ILSYNKGDLIFLD

Ligand information

>3ulp Chain R (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttttttttttttttttttttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ulp Plasmodium falciparum SSB Tetramer Wraps Single-Stranded DNA with Similar Topology but Opposite Polarity to E. coli SSB.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Y148 R153
Binding residue (residue number reindexed from 1)	Y70 R75

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003697	single-stranded DNA binding

	Biological Process
GO:0006260	DNA replication

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3ulp, PDBe:3ulp, PDBj:3ulp
PDBsum	3ulp
PubMed	22543099
UniProt	Q8I415

[Back to BioLiP]