Structure of PDB 3ueo Chain D Binding Site BS01

Receptor Information
>3ueo Chain D (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLFSQKSFLVLGFSNENESNIANIIKENAGKIMVADYAVVPLLGCEVEAT
VGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQC
AGAEKESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYE
AAKKWNLPAVTIAWLLETARTGKRADESHFLIENST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ueo Structural insights into recognition of MDC1 by TopBP1 in DNA replication checkpoint control.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
S654 Q655 Y678 F679 K687 E699 S703 K704 W711
Binding residue
(residue number reindexed from 1)
S98 Q99 Y122 F123 K131 E143 S147 K148 W155
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ueo, PDBe:3ueo, PDBj:3ueo
PDBsum3ueo
PubMed23891287
UniProtQ92547|TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 (Gene Name=TOPBP1)

[Back to BioLiP]