Structure of PDB 3u3f Chain D Binding Site BS01

Receptor Information
>3u3f Chain D (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDD
LLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQM
LTASHTLAVDAKNLLDAVDQAKVLAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u3f Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
Resolution3.101 Å
Binding residue
(original residue number in PDB)		G914 L915 R918 N947 A951 I954 R958
Binding residue
(residue number reindexed from 1)		G38 L39 R42 N71 A75 I78 R82
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3u3f, PDBe:3u3f, PDBj:3u3f
PDBsum3u3f
PubMed25174335
UniProtQ14289|FAK2_HUMAN Protein-tyrosine kinase 2-beta (Gene Name=PTK2B)

[Back to BioLiP]