Structure of PDB 3td5 Chain D Binding Site BS01

Receptor Information
>3td5 Chain D (length=120) Species: 470 (Acinetobacter baumannii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGH
TDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADN
KTKEGRAMNRRVFATITGSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3td5 Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T236 N237 T270 D271 T273 L278 N279 L282 R286 R325 R329
Binding residue
(residue number reindexed from 1)		T17 N18 T51 D52 T54 L59 N60 L63 R67 R106 R110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:3td5, PDBe:3td5, PDBj:3td5
PDBsum3td5
PubMed21965596
UniProtQ6RYW5|OMP38_ACIB2 Outer membrane protein Omp38 (Gene Name=omp38)

[Back to BioLiP]