Structure of PDB 3s6i Chain D Binding Site BS01

Receptor Information

>3s6i Chain D (length=207) Species: 284812 (Schizosaccharomyces pombe 972h-)

TKAEIHLSGLDENWKRLVKLVGNYRPNRSMEKKEPYEELIRAVASQQLHS
KAANAIFNRFKSISNNGQFPTPEEIRDMDFEIMRACGFSARKIDSLKSIA
EATISGLIPTKEEAERLSNEELIERLTQIKGIGRWTVEMLLIFSLNRDDV
MPADDLSIRNGYRYLHRLPKIPTKMYVLKHSEICAPFRTAAAWYLWKTSK
LADYTKP

Ligand information

>3s6i Chain B (length=11)

tgtccacgtct

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3s6i Analysis of substrate specificity of Schizosaccharomyces pombe Mag1 alkylpurine DNA glycosylase.
• Resolution: 2.28 Å
• Binding residue (original residue number in PDB): N42 S44 E53 R56 A57 N69 M154 F158
• Binding residue (residue number reindexed from 1): N27 S29 E38 R41 A42 N54 M139 F143

Enzymatic activity

• Catalytic site (original residue number in PDB): M154 W211
• Catalytic site (residue number reindexed from 1): M139 W196
• Enzyme Commision number: 3.2.2.21: DNA-3-methyladenine glycosylase II.

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0003824 catalytic activity
• GO:0003905 alkylbase DNA N-glycosylase activity
• GO:0008725 DNA-3-methyladenine glycosylase activity
• GO:0016787 hydrolase activity
• GO:0032131 alkylated DNA binding
• GO:0043916 DNA-7-methylguanine glycosylase activity
• GO:0052820 DNA-1,N6-ethenoadenine N-glycosylase activity
• GO:0052821 DNA-7-methyladenine glycosylase activity
• GO:0052822 DNA-3-methylguanine glycosylase activity

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006285 base-excision repair, AP site formation
• GO:0006307 DNA alkylation repair

Cellular Component

• GO:0005634 nucleus
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3s6i, PDBe:3s6i, PDBj:3s6i
• PDBsum: 3s6i
• PubMed: 21960007
• UniProt: Q92383|MAG1_SCHPO DNA-3-methyladenine glycosylase 1 (Gene Name=mag1)