Structure of PDB 3s5l Chain D Binding Site BS01

Receptor Information
>3s5l Chain D (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKQWEFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3s5l Affinity maturation of human CD4 by yeast surface display and crystal structure of a CD4-HLA-DR1 complex.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Q9 E11 F22 W43 A52 S53 F54 G58 N62 D66 N69 M73
Binding residue
(residue number reindexed from 1)		Q7 E9 F20 W41 A50 S51 F52 G56 N60 D64 N67 M71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3s5l, PDBe:3s5l, PDBj:3s5l
PDBsum3s5l
PubMed21900604
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]