Structure of PDB 3rl7 Chain D Binding Site BS01

Receptor Information
>3rl7 Chain D (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDG
RLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rl7 Molecular basis for the recognition of adenomatous polyposis coli by the Discs Large 1 protein.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
F236 S237 I238 N244 P245 H289 V293
Binding residue
(residue number reindexed from 1)
F18 S19 I20 N26 P27 H71 V75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3rl7, PDBe:3rl7, PDBj:3rl7
PDBsum3rl7
PubMed21858148
UniProtQ12959|DLG1_HUMAN Disks large homolog 1 (Gene Name=DLG1)

[Back to BioLiP]