Structure of PDB 3rjm Chain D Binding Site BS01

Receptor Information

>3rjm Chain D (length=97) Species: 9606 (Homo sapiens)

KMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVA
DMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP

Ligand information

>3rjm Chain F (length=5)

VDVPD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3rjm Exploiting differences in caspase-2 and -3 S(2) subsites for selectivity: Structure-based design, solid-phase synthesis and in vitro activity of novel substrate-based caspase-2 inhibitors.
• Resolution: 2.55 Å
• Binding residue (original residue number in PDB): A228 A229 M230 R231 N232 T233 W238 G272 Y273 F279
• Binding residue (residue number reindexed from 1): A21 A22 M23 R24 N25 T26 W31 G65 Y66 F72

Enzymatic activity

• Enzyme Commision number: 3.4.22.55: caspase-2.

Gene Ontology

Molecular Function

• GO:0004197 cysteine-type endopeptidase activity
• GO:0008234 cysteine-type peptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:3rjm, PDBe:3rjm, PDBj:3rjm
• PDBsum: 3rjm
• PubMed: 21903398
• UniProt: P42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)