Structure of PDB 3r1l Chain D Binding Site BS01

Receptor Information
>3r1l Chain D (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Ligand information
>3r1l Chain F (length=130) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaacacuauacuacuggauaaucaaagacaaaucugcccgaaggguuug
agaacauacccauugcacuccggguaugcagagguggcagccuccggugg
guuaaaacccaacguucucaacaauaguga
(...<<<<<<.)......................(((((........<<<
<<<<<<<<<<<..........>>>>>>>..<<<<.)))))>>>><<.<<<
<<....>>>>>.>>>>>>>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r1l The structural basis of RNA-catalyzed RNA polymerization.
Resolution3.125 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 S48 L49 K50 M51 R52 Q54 F56 K88 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K17 S43 L44 K45 M46 R47 Q49 F51 K83 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3r1l, PDBe:3r1l, PDBj:3r1l
PDBsum3r1l
PubMed21857665
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]