Structure of PDB 3qym Chain D Binding Site BS01

Receptor Information

>3qym Chain D (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQI
KVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSH
LIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV
GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI

Ligand information

>3qym Chain L (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacatgttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3qym Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	S272 R304 A307 R311
Binding residue (residue number reindexed from 1)	S148 R180 A183 R187
Binding affinity	PDBbind-CN: Kd=11.7uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3qym, PDBe:3qym, PDBj:3qym
PDBsum	3qym
PubMed	21464285
UniProt	Q9H3D4\|P63_HUMAN Tumor protein 63 (Gene Name=TP63)

[Back to BioLiP]