Structure of PDB 3qsv Chain D Binding Site BS01

Receptor Information
>3qsv Chain D (length=125) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAI
TTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKH
VKYCQYAFDLKCDSVCVNPYHYERV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qsv Structural basis for DNA recognition by constitutive Smad4 MH1 dimers
Resolution2.708 Å
Binding residue
(original residue number in PDB)		R81 K88 K106
Binding residue
(residue number reindexed from 1)		R70 K77 K95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qsv, PDBe:3qsv, PDBj:3qsv
PDBsum3qsv
PubMed
UniProtP97471|SMAD4_MOUSE Mothers against decapentaplegic homolog 4 (Gene Name=Smad4)

[Back to BioLiP]