Structure of PDB 3qo2 Chain D Binding Site BS01

Receptor Information
>3qo2 Chain D (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLE
FRKKIAENK
Ligand information
>3qo2 Chain P (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKSTGGKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qo2 Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		K73 D88 T89 W90 P92
Binding residue
(residue number reindexed from 1)		K18 D33 T34 W35 P37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3qo2, PDBe:3qo2, PDBj:3qo2
PDBsum3qo2
PubMed21419134
UniProtQ99549|MPP8_HUMAN M-phase phosphoprotein 8 (Gene Name=MPHOSPH8)

[Back to BioLiP]