Structure of PDB 3qdz Chain D Binding Site BS01

Receptor Information
>3qdz Chain D (length=257) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRNI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTA
NVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDA
CEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWI
QKVIDQF
Ligand information
>3qdz Chain C (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EADCGLRPLFEKKSLEDKTERELLESYID
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qdz Molecular dissection of Na+ binding to thrombin.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
E23 M26 S115 H119 P120 V121 C122 L129C Y134 K135 R137 N159 M201 K202 N205 R206 W207
Binding residue
(residue number reindexed from 1)
E8 M11 S112 H116 P117 V118 C119 L129 Y134 K135 R137 N164 M211 K212 N217 R218 W219
Enzymatic activity
Catalytic site (original residue number in PDB) H57 N102 E192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H43 N99 E202 G203 D204 S205 G206
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3qdz, PDBe:3qdz, PDBj:3qdz
PDBsum3qdz
PubMed
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]