Structure of PDB 3p4u Chain D Binding Site BS01

Receptor Information
>3p4u Chain D (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTE
LLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p4u Crystal structures of active and inhibitor-bound human Casp6
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y217 S218 H219 R220 E221 T222 X264
Binding residue
(residue number reindexed from 1)		Y20 S21 H22 R23 E24 T25 X67
Enzymatic activity
Enzyme Commision number 3.4.22.59: caspase-6.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3p4u, PDBe:3p4u, PDBj:3p4u
PDBsum3p4u
PubMed
UniProtP55212|CASP6_HUMAN Caspase-6 (Gene Name=CASP6)

[Back to BioLiP]