Structure of PDB 3olr Chain D Binding Site BS01

Receptor Information
>3olr Chain D (length=297) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASMDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTT
VAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPK
AYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCERYWAEPG
EMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHD
VPSSIDPILELIWDVRCYQEDDSVPICIHSSAGCGRTGVICAIDYTWMLL
KDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3olr Structure basis of LYP substrate specificity revealed by reverse alanine screening and crystallography
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R59 Y60 K61 D62 M134 S227 S228 A229 C231 G232 R233 Q274
Binding residue
(residue number reindexed from 1)		R62 Y63 K64 D65 M137 S230 S231 A232 C234 G235 R236 Q277
Enzymatic activity
Catalytic site (original residue number in PDB) D195 S227 R233 T234 Q274
Catalytic site (residue number reindexed from 1) D198 S230 R236 T237 Q277
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3olr, PDBe:3olr, PDBj:3olr
PDBsum3olr
PubMed
UniProtQ9Y2R2|PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 (Gene Name=PTPN22)

[Back to BioLiP]