Structure of PDB 3mv8 Chain D Binding Site BS01

Receptor Information
>3mv8 Chain D (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYS
AGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTF
GEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDS
DVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
>3mv8 Chain C (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGEADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mv8 Allelic polymorphism in the T cell receptor and its impact on immune responses
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R31 L109 S112 G113 S114
Binding residue
(residue number reindexed from 1)		R29 L91 S94 G95 S96
External links