Structure of PDB 3jxb Chain D Binding Site BS01

Receptor Information
>3jxb Chain D (length=65) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLAL
SKALQCSPDYLLKGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jxb Sequence Recognition of DNA by Protein-Induced Conformational Transitions
Resolution1.67 Å
Binding residue
(original residue number in PDB)		R11 R20 Q21 N32 V33 S36 R40
Binding residue
(residue number reindexed from 1)		R8 R17 Q18 N29 V30 S33 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3jxb, PDBe:3jxb, PDBj:3jxb
PDBsum3jxb
PubMed20053356
UniProtP69202|RPC2_BPP22 Repressor protein C2 (Gene Name=C2)

[Back to BioLiP]