Structure of PDB 3jtt Chain D Binding Site BS01

Receptor Information
>3jtt Chain D (length=276) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTSMSRPGRWEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WVEQEGPEYWDRETRNMKAETQNAPVNLRNLRGYYNQSEAGSHTIQRMYG
CDLGPDGRLLRGYHQSAYDGKDYIALNEDLRSWTAADMAAQNTQRKWEAA
GEAEQHRTYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDQEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGKEQRYTCHVQHEGLREPLTLRWEP
Ligand information
>3jtt Chain F (length=9) Species: 11723 (Simian immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YTSGPGIRY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jtt Crystal structure of Rhesus macaque MHC class I:Mamu-A*02
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y7 R62 E63 N66 V76 N77 L81 Y84 Y99 S116 T143 K146 W147 E152 Y159 E163 W167
Binding residue
(residue number reindexed from 1)		Y7 R62 E63 N66 V76 N77 L81 Y84 Y99 S116 T143 K146 W147 E152 Y159 E163 W167
Enzymatic activity
Enzyme Commision number ?
External links