Structure of PDB 3iwn Chain D Binding Site BS01

Receptor Information
>3iwn Chain D (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3iwn Chain A (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacgcacagggcaaaccauucgaaagagugggacgcaaagccuccggccu
aaacggcauugcacuccgccguagguagcgggguuaccgaugg
<<<<......<<...<<<<<<....>>>>>>...>>...<<<.<<<<<<<
..<<<<<..........>>>>>>>>>..>>>>>>...>>.>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3iwn Recognition of the bacterial second messenger cyclic diguanylate by its cognate riboswitch.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T901 R965 Q968 G969 R978 Y981
Binding residue
(residue number reindexed from 1)		T1 R65 Q68 G69 R78 Y81
Binding affinityPDBbind-CN: Kd=1nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3iwn, PDBe:3iwn, PDBj:3iwn
PDBsum3iwn
PubMed19898478
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]