Structure of PDB 3irq Chain D Binding Site BS01

Receptor Information
>3irq Chain D (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKL
QKEAGTPPLWKIAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3irq Crystal structure of a junction between two Z-DNA helices.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N173 R174 Y177 T191 P192 P193
Binding residue
(residue number reindexed from 1)		N38 R39 Y42 T56 P57 P58
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:3irq, PDBe:3irq, PDBj:3irq
PDBsum3irq
PubMed20439751
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]