Structure of PDB 3hsb Chain D Binding Site BS01

Receptor Information
>3hsb Chain D (length=67) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEGKQQLI
YKHAISTFAPQKNVQLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hsb Crystal structure of Hfq from Bacillus subtilis in complex with SELEX-derived RNA aptamer: insight into RNA-binding properties of bacterial Hfq
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F24 G28 S60 T61
Binding residue
(residue number reindexed from 1)		F20 G24 S56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3hsb, PDBe:3hsb, PDBj:3hsb
PDBsum3hsb
PubMed22053080
UniProtO31796|HFQ_BACSU RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]